Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#4956
LocusCMV037C [Show EST mapping]
LocationCPDNA 23962<24426 [Show ORF map]
Annotationprobable tetrapyrrole-binding protein GUN4
Commentsmay be a remnant, because N-terminal sequence seems truncated in comparison with homologs. GENE{ycf53} GI{30409173}
Deduced sequenceMDKKSIWHRSDLDQLAKQLEEEDFLSANQTTYKLMCQWAGCGEREWIYFTEIAMIPNEAI
REIDELWKKYSKGKFGYGVQRRIWLAKQKDWMKFWEQIGWVKQGQWLRYPNEFEWSLDAP
EGHLPLWNQLRGVQALERLFTHDVWLSVGNVQINK

(155 aa; 18.73 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST