Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#4993
LocusCMV076C [Show EST mapping]
LocationCPDNA 49268<49828 [Show ORF map]
Annotationanthranilate synthase component II
Commentsanthranilate synthase beta subunit; GENE{trpG} EC{4.1.3.27} GI{30409210}
Deduced sequenceMILLIDNYDSFTFNLVHSLSHSDLILCRNDELDLSSLSLLPIRSIIISPGPGHPRDLSHA
IPFLSHYLPRVPILGVCLGHQLLAQLFHWHVKPAPSPLHGKVSLIFHQHDFLFQDVPNPF
QATRYHSLLAYPTPHSPLLAIAHSSDGLVMAFKHSSFPLYGVQFHPESILTTHGLQIFRN
FLSLSSP

(187 aa; 20.98 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST