Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#5152
LocusCMW026C [Show EST mapping]
LocationMTDNA 15093<15482 [Show ORF map]
AnnotationATP synthase A chain (protein 8)
CommentsGENE{atp8} EC{3.6.1.34} GI{4115787}
Deduced sequenceMPQLDRVIIVTQIFWLLLIMIVAYSFVIKRILPSSFRILKIRENFIKDLILNVEKLNKEQ
NTQLKNTIKLNQHYINLIKNIILVQNKFYDEILSNYYKIFIKKINLKETFFTYASFMQLY
KNLIQRYLIN

(130 aa; 15.84 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST