Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#5162
LocusCMW037C [Show EST mapping]
LocationMTDNA 21342<21722 [Show ORF map]
Annotation50S ribosomal protein L14
CommentsGENE{rpl14} GI{4115797}
Deduced sequenceMIYKGTYLRVIDNSGATLAKCIGILGSNSPKYAKVGSTIIVTIKELYRSNNSVRSKIEKG
IISHALIVRTKKKNRSLDNIWTNFIDNGVVLLDNKKSLMFTRVRGPIHYALRFKKFIKVL
SLSKYNL

(127 aa; 14.39 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST