Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#5163
LocusCMW038C [Show EST mapping]
LocationMTDNA 21748<22191 [Show ORF map]
Annotation50S ribosomal protein L16
CommentsGENE{rpl16} GI{4115798}
Deduced sequenceMSVNKRTFKKNFLPSLKKKAKNSFIENYGNFSLKATESGYITASQLETVKRISIKFLKDH
GSNQLRMGKQNIVWLRVHPTFFVTSKGSEVRIGGGKGSLKTRVAKIDSGQIILEFNLESI
TIARKLLKLISIRLPIKIVLNSNINLES

(148 aa; 16.66 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST