Cyanidioschyzon merolae Genome Project v3

Home / Introduction / Browser / BLAST / Publications / Download / Member
CDS#5164
LocusCMW039C [Show EST mapping]
LocationMTDNA 22237<23082 [Show ORF map]
Annotation30S ribosomal protein S3
CommentsGENE{rps3} GI{4115799}
Deduced sequenceMSHKIRPENYRLGYLFDWKNDWYTHNINYSNFLIKNLKISEYLNRILYKNFLFLGDLTLK
SNALKVLISLTCYPCKDSYKNTNWDLINHLCQLYFQKSVQINYYYRHTLLEHPNFITNWL
CFLLEKEYDLKIILNQVKNFIKKTQENEYQINKKTQNFIRSKNFETTKKLIETKNFQANT
SYRSSNSLHSSTRSETYSGNYYCSHCINSYDRFFSTKIVLLRGLKIIIRGRLHGLQNQIS
TVESIEIGTVPLQTKEHEILYSTRDFVTKYGVYGIQVWIFYN

(282 aa; 33.87 kDa) [BLAST result]
Features[TransMembrane]
Dispatch[CD Search/SMART]
External[KEGG/GFIT]
Reference: Matsuzaki, M. et al. Nature 428, 653-657 (2004)
Nozaki, H. et al. BMC Biology 5, 28 (2007)
Last modified: 2019-12-26 17:05:39 JST